PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010941405.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 265aa    MW: 30258.5 Da    PI: 7.6512
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010941405.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.8e-49111373128
             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                     pGfrFhPt+eel+++yLk+ v+gkkl++ ++i ++++y+++Pw+Lp  +k +e+ewyfF++rd+k+++g r+nr+t++g+Wkatg+d+++ s+  
  XP_010941405.1  11 PGFRFHPTEEELLDFYLKRAVQGKKLQV-DIIGTLNLYRHDPWELPGLAKIGEREWYFFVPRDRKQSNGGRPNRTTEHGFWKATGSDRPIRSAad 104
                     9***************************.99***************8888899**************************************9877 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++l+glkktLv+y+grap+g+ktdW+m+eyrl
  XP_010941405.1 105 PKRLIGLKKTLVYYHGRAPRGSKTDWIMNEYRL 137
                     7788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.1569156IPR003441NAC domain
SuperFamilySSF1019411.96E-5610156IPR003441NAC domain
PfamPF023653.8E-2511137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MEQSGGGLEL PGFRFHPTEE ELLDFYLKRA VQGKKLQVDI IGTLNLYRHD PWELPGLAKI  60
GEREWYFFVP RDRKQSNGGR PNRTTEHGFW KATGSDRPIR SAADPKRLIG LKKTLVYYHG  120
RAPRGSKTDW IMNEYRLPDL TTPPKEDIVL CKVYRKATSL KELEQKAAMA SPNSGLTMES  180
SSDQEISQKL MAMDDDGGVK EAKENEVEKK EEAGVVAKST WSVNLPKLEV PTYNDLEWMQ  240
DSFLTQLRSP WMVPLSPFYG SMLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-511115617168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941405.10.0PREDICTED: protein FEZ-like
SwissprotQ9FIW54e-57NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLM0TEJ31e-118M0TEJ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P04030_0011e-117(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.13e-90NAC domain containing protein 36